Homework5

David Liu, a student in department of Life Sciences, got bit by a snake in the backyard of life science building. He was so angry! Thus, he killed the snake and purified several toxins from its venoms. He sequenced one of the toxin, got this sequence:

1 L K C N K L V P L F Y K T C P A G K N L C Y K M F M V A T P

31 K V P V K R G C I D V C P K S S L L V K Y V C C N T D R C N

(1) Is this a new toxin? Please help him to identify this toxin.

This is not a new toxin.

From NCBI , We know that it is cytotoxin 3 - Chinese cobra.

Homology protein Secondary stucture Charge distribution

(2) Can you find proteins that share sequence homology with this toxin?

Show them in multiple alignment form.

H3NJ3F - cytotoxin 3 - Chinese cobra
H3NJ2I - cytotoxin 2 - Naja naja
JS0028 - cytotoxin II - monocled cobra
H3NJ5F - cytotoxin 5 - Chinese cobra
JC2469 - cardiotoxin - Chinese cobra
H3NJ2R - cytotoxin 2 - Asian cobra
H3NJ2F - cytotoxin 2 - Chinese cobra
H3NJ2K - cytotoxin 2 - monocled cobra
H3NJ4F - cytotoxin 4 - Chinese cobra
H3NJ3K - cytotoxin 3 - monocled cobra

yellow : consensus
green : conserve
blue : amino acid carry the same charge in the same coloum

(3) Please predict its secondary structure.

Garnier plot of cytotoxin 3 - Chinese cobra

60 aa; DCH = 0, DCS = 0
            
           .   10    .   20    .   30    .   40    .   50    .   60
       LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
 helix H                 HHH     HHHH                              
 sheet     EEEEEEEEE        EEEEE      E E  EEEEE    EEEEEEEE      
 turns  TTT          TTTT            T  T TT     TTTT        TTTTTT
 coil               C                 C                            

Residue totals: H: 8 E: 29 T: 21 C: 2

percent: H: 18.2 E: 65.9 T: 47.7 C: 4.5

(4) Please show its charge distribution.

Charge distributional analysis of cytotoxin 3 - Chinese cobra : From the first amino acid to the last (1--60)

1 0+00+00000 0+00000+00 00+0000000 +000++000- 000+00000+ 000000-+00